PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00181.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 308aa    MW: 34004.2 Da    PI: 8.9808
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00181.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.61.2e-135485940
                      TCR  9 kkskClkkYCeCfaagkkCseeCkCedCkNke 40
                             k +kClk+YCeCf+ag++C e C+C dC+Nk 
  Rsa1.0_00181.1_g00004.1 54 KSQKCLKLYCECFSAGVYCIEPCSCVDCFNKP 85
                             6789**************************96 PP

2TCR55.41.2e-17133170239
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              +k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN 
  Rsa1.0_00181.1_g00004.1 133 HKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNA 170
                              799**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163434.01947172IPR005172CRC domain
SMARTSM011141.9E-105387IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.2E-105484IPR005172CRC domain
SMARTSM011141.4E-16132173IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.8E-13134170IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MISKLCVDNK AESSPKHVAL GIDLHLNAIA MSSRDRPGLS KLERVIHVSD ATAKSQKCLK  60
LYCECFSAGV YCIEPCSCVD CFNKPIHEDT VLATRKQIES RNPLAFAPKV IRNSDSITEV  120
GEDASKTPAS APHKRGCNCK KSNCLKKYCE CFQSGVGCSI NCRCEGCKNA FGRKDACLLA  180
IMESKQEEDH KTYEKRPSKI QENKQVEQNP SSDQPSTPLP PYRHLMVHQP FFSKNRLPPT  240
QFFLGVEKTE ILSINPITTI KAISPNSKRV SPPQLGSSGT GSILVKRSDG RKLILRSIPA  300
FPSLNPNQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040591e-162AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063241e-162AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
GenBankAY0460191e-162AY046019.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
GenBankAY1426421e-162AY142642.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406129.11e-148hypothetical protein EUTSA_v10020174mg
SwissprotQ9LUI31e-144TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLV4LYI41e-148V4LYI4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__2490__AT3G22780.11e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-146Tesmin/TSO1-like CXC domain-containing protein